SCOPe 2.07: Domain d4qwfx_: 4qwf X:

Lineage for d4qwfx_ (4qwf X:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qwfx_: 4qwf X: [308806]
   Other proteins in same PDB: d4qwfb_, d4qwfc_, d4qwff_, d4qwfg_, d4qwfh_, d4qwfm_, d4qwfp_, d4qwfq_, d4qwft_, d4qwfu_, d4qwfv_
   automated match to d4j70j_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qwfx_

PDB Entry: 4qwf, 3 Å

PDB Description: yCP beta5-M45I mutant in complex with carfilzomib

PDB Compounds: (X:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4qwfx_:

Sequence; same for both SEQRES and ATOM records:

>d4qwfx_ d.153.1.4 (X:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

Timeline for d4qwfx_:

• d4qwfx_ first appeared in SCOPe 2.06
  
• d4qwfx_ appears in the current release, SCOPe 2.08