Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) |
Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
Protein Ribosomal protein L15 (L15p) [52082] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [52083] (18 PDB entries) |
Domain d1ffkj_: 1ffk J: [30880] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_ complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffkj_:
Sequence, based on SEQRES records: (download)
>d1ffkj_ c.12.1.1 (J:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui} tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl iaddfsegarekvegaggsveltdlgeerqa
>d1ffkj_ c.12.1.1 (J:) Ribosomal protein L15 (L15p) {Archaeon Haloarcula marismortui} tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee aatidvreidenvtllaaddvaedvrdvveeaddadyvkvlgagqvrheltliaddfseg arekvegaggsveltdlgeerqa
Timeline for d1ffkj_: