Lineage for d1ds9a_ (1ds9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2852055Superfamily c.10.3: Outer arm dynein light chain 1 [52075] (1 family) (S)
    (beta-beta-alpha)n superhelix
  5. 2852056Family c.10.3.1: Outer arm dynein light chain 1 [52076] (2 proteins)
    this is a repeat family; one repeat unit is 1ds9 A:84-107 found in domain
  6. 2852057Protein Outer arm dynein light chain 1 [52077] (1 species)
  7. 2852058Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [52078] (2 PDB entries)
  8. 2852060Domain d1ds9a_: 1ds9 A: [30879]

Details for d1ds9a_

PDB Entry: 1ds9 (more details)

PDB Description: solution structure of chlamydomonas outer arm dynein light chain 1
PDB Compounds: (A:) outer arm dynein

SCOPe Domain Sequences for d1ds9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds9a_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
makattikdairifeerksvvateaekvelhgmippiekmdatlstlkackhlalstnni
ekisslsgmenlrilslgrnlikkienldavadtleelwisynqiaslsgieklvnlrvl
ymsnnkitnwgeidklaaldkledlllagnplyndykennatseyrievvkrlpnlkkld
gmpvdvdereqanvargg

SCOPe Domain Coordinates for d1ds9a_:

Click to download the PDB-style file with coordinates for d1ds9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ds9a_: