Lineage for d1igra2 (1igr A:300-478)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21460Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 21488Superfamily c.10.2: L domain-like [52058] (5 families) (S)
  5. 21512Family c.10.2.5: L1 and L2 domains of the type 1 insulin-like growth factor receptor [52071] (1 protein)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 21513Protein L1 and L2 domains of the type 1 insulin-like growth factor receptor [52072] (1 species)
  7. 21514Species Human (Homo sapiens) [TaxId:9606] [52073] (1 PDB entry)
  8. 21516Domain d1igra2: 1igr A:300-478 [30878]
    Other proteins in same PDB: d1igra3

Details for d1igra2

PDB Entry: 1igr (more details), 2.6 Å

PDB Description: type 1 insulin-like growth factor receptor (domains 1-3)

SCOP Domain Sequences for d1igra2:

Sequence, based on SEQRES records: (download)

>d1igra2 c.10.2.5 (A:300-478) L1 and L2 domains of the type 1 insulin-like growth factor receptor {Human (Homo sapiens)}
kvceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvk
irhshalvslsflknlrlilgeeqlegnysfyvldnqnlqqlwdwdhrnltikagkmyfa
fnpklcvseiyrmeevtgtkgrqskgdintrnngerascesdvddddkeqkliseedln

Sequence, based on observed residues (ATOM records): (download)

>d1igra2 c.10.2.5 (A:300-478) L1 and L2 domains of the type 1 insulin-like growth factor receptor {Human (Homo sapiens)}
kvceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvk
irhshalvslsflknlrlilgeeqlegnysfyvldnqnlqqlwdwdhrnltikagkmyfa
fnpklcvseiyrmeevtgtkgrqskgdintrnngerascekeqkliseedln

SCOP Domain Coordinates for d1igra2:

Click to download the PDB-style file with coordinates for d1igra2.
(The format of our PDB-style files is described here.)

Timeline for d1igra2: