Lineage for d1igra1 (1igr A:1-149)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353403Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1353461Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1353531Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 1353578Protein Type 1 insulin-like growth factor receptor extracellular domain [52072] (1 species)
  7. 1353579Species Human (Homo sapiens) [TaxId:9606] [52073] (1 PDB entry)
    L1 and L2 domains
  8. 1353580Domain d1igra1: 1igr A:1-149 [30877]
    Other proteins in same PDB: d1igra3
    complexed with nag, so4

Details for d1igra1

PDB Entry: 1igr (more details), 2.6 Å

PDB Description: type 1 insulin-like growth factor receptor (domains 1-3)
PDB Compounds: (A:) insulin-like growth factor receptor 1

SCOPe Domain Sequences for d1igra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igra1 c.10.2.5 (A:1-149) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
eicgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrv
agleslgdlfpnltvirgwklfynyalvifemtnlkdiglynlrnitrgairieknadlc
ylstvdwslildavsnnyivgnkppkecg

SCOPe Domain Coordinates for d1igra1:

Click to download the PDB-style file with coordinates for d1igra1.
(The format of our PDB-style files is described here.)

Timeline for d1igra1: