![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
![]() | Protein Type 1 insulin-like growth factor receptor extracellular domain [52072] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52073] (1 PDB entry) L1 and L2 domains |
![]() | Domain d1igra1: 1igr A:1-149 [30877] Other proteins in same PDB: d1igra3 complexed with nag, so4 |
PDB Entry: 1igr (more details), 2.6 Å
SCOPe Domain Sequences for d1igra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igra1 c.10.2.5 (A:1-149) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} eicgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrv agleslgdlfpnltvirgwklfynyalvifemtnlkdiglynlrnitrgairieknadlc ylstvdwslildavsnnyivgnkppkecg
Timeline for d1igra1: