SCOPe 2.07: Domain d4qw7f_: 4qw7 F:

Lineage for d4qw7f_ (4qw7 F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qw7f_: 4qw7 F: [308765]
   Other proteins in same PDB: d4qw7a_, d4qw7c_, d4qw7d_, d4qw7e_, d4qw7g_, d4qw7i_, d4qw7j_, d4qw7k_, d4qw7l_, d4qw7n_, d4qw7o_, d4qw7q_, d4qw7r_, d4qw7s_, d4qw7u_, d4qw7w_, d4qw7x_, d4qw7y_, d4qw7z_
   automated match to d4g4sg_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qw7f_

PDB Entry: 4qw7, 2.7 Å

PDB Description: yCP beta5-M45T mutant in complex with carfilzomib

PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qw7f_:

Sequence; same for both SEQRES and ATOM records:

>d4qw7f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d4qw7f_:

• d4qw7f_ first appeared in SCOPe 2.06
  
• d4qw7f_ appears in the current release, SCOPe 2.08