SCOP 1.69: Domain d1a9nc_: 1a9n C:

Lineage for d1a9nc_ (1a9n C:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (8 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.4: U2A'-like [52068] (1 protein)
   duplication: consists of 5-6 partly irregular repeats
   this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain

6. Protein Splicesomal U2A' protein [52069] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52070] (1 PDB entry)

8. Domain d1a9nc_: 1a9n C: [30876]
   Other proteins in same PDB: d1a9nb_, d1a9nd_

Details for d1a9nc_

PDB Entry: 1a9n, 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna

SCOP Domain Sequences for d1a9nc_:

Sequence; same for both SEQRES and ATOM records:

>d1a9nc_ c.10.2.4 (C:) Splicesomal U2A' protein {Human (Homo sapiens)}
vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfkgkrgaqlakdia

Timeline for d1a9nc_:

• d1a9nc_ first appeared (with stable ids) in SCOP 1.55
  
• d1a9nc_ appears in SCOP 1.67
  
• d1a9nc_ appears in SCOP 1.71
  
• d1a9nc_ appears in the current release, SCOPe 2.08