Lineage for d1a9na_ (1a9n A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240418Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 240457Superfamily c.10.2: L domain-like [52058] (7 families) (S)
    less regular structure consisting of variable repeats
  5. 240495Family c.10.2.4: U2A'-like [52068] (1 protein)
    duplication: consists of 5-6 partly irregular repeats
  6. 240496Protein Splicesomal U2A' protein [52069] (1 species)
  7. 240497Species Human (Homo sapiens) [TaxId:9606] [52070] (1 PDB entry)
  8. 240498Domain d1a9na_: 1a9n A: [30875]
    Other proteins in same PDB: d1a9nb_, d1a9nd_

Details for d1a9na_

PDB Entry: 1a9n (more details), 2.38 Å

PDB Description: crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna

SCOP Domain Sequences for d1a9na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens)}
vkltaelieqaaqytnavrdreldlrgykipvienlgatldqfdaidfsdneirkldgfp
llrrlktllvnnnricrigegldqalpdlteliltnnslvelgdldplaslksltylcil
rnpvtnkkhyrlyviykvpqvrvldfqkvklkerqeaekmfk

SCOP Domain Coordinates for d1a9na_:

Click to download the PDB-style file with coordinates for d1a9na_.
(The format of our PDB-style files is described here.)

Timeline for d1a9na_: