Lineage for d1ft8d_ (1ft8 D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823992Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 824043Superfamily c.10.2: L domain-like [52058] (8 families) (S)
    less regular structure consisting of variable repeats
  5. 824075Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
    this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain
  6. 824076Protein mRNA export factor tap [52066] (1 species)
  7. 824077Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)
  8. 824091Domain d1ft8d_: 1ft8 D: [30874]
    Other proteins in same PDB: d1ft8a2, d1ft8c2, d1ft8e_
    mutant

Details for d1ft8d_

PDB Entry: 1ft8 (more details), 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap
PDB Compounds: (D:) tip associating protein

SCOP Domain Sequences for d1ft8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft8d_ c.10.2.3 (D:) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
lkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriieen
ipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwld
gnslcdtfrdqstyisairerfpkllrldghelpppiafdve

SCOP Domain Coordinates for d1ft8d_:

Click to download the PDB-style file with coordinates for d1ft8d_.
(The format of our PDB-style files is described here.)

Timeline for d1ft8d_: