SCOPe 2.07: Domain d4qw5u_: 4qw5 U:

Lineage for d4qw5u_ (4qw5 U:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qw5u_: 4qw5 U: [308731]
   Other proteins in same PDB: d4qw5a_, d4qw5c_, d4qw5e_, d4qw5i_, d4qw5j_, d4qw5k_, d4qw5l_, d4qw5n_, d4qw5o_, d4qw5q_, d4qw5s_, d4qw5w_, d4qw5x_, d4qw5y_, d4qw5z_
   automated match to d1rypa_
   complexed with 3bv, cl, mes, mg; mutant

Details for d4qw5u_

PDB Entry: 4qw5, 3 Å

PDB Description: yCP beta5-M45A mutant in complex with carfilzomib

PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4qw5u_:

Sequence; same for both SEQRES and ATOM records:

>d4qw5u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

Timeline for d4qw5u_:

• d4qw5u_ first appeared in SCOPe 2.06
  
• d4qw5u_ appears in the current release, SCOPe 2.08