SCOPe 2.01: Domain d1fo1b_: 1fo1 B:

Lineage for d1fo1b_ (1fo1 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
   this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain

6. Protein mRNA export factor tap [52066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)

8. Domain d1fo1b_: 1fo1 B: [30870]
   Other proteins in same PDB: d1fo1a2

Details for d1fo1b_

PDB Entry: 1fo1, 2.9 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

PDB Compounds: (B:) nuclear RNA export factor 1

SCOPe Domain Sequences for d1fo1b_:

Sequence; same for both SEQRES and ATOM records:

>d1fo1b_ c.10.2.3 (B:) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}
elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
dgnslcdtfrdqstyisairerfpkllrldghelpppiafdve

Timeline for d1fo1b_:

• d1fo1b_ first appeared (with stable ids) in SCOP 1.55, called d1fo1b1
  
• d1fo1b_ appears in SCOP 1.75
  
• d1fo1b_ appears in SCOPe 2.02
  
• d1fo1b_ appears in the current release, SCOPe 2.08