| Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) |
Superfamily c.10.2: L domain-like [52058] (5 families) ![]() |
| Family c.10.2.3: mRNA export factor tap [52065] (1 protein) this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain |
| Protein mRNA export factor tap [52066] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52067] (2 PDB entries) |
| Domain d1fo1b1: 1fo1 B: [30870] Other proteins in same PDB: d1fo1a2 |
PDB Entry: 1fo1 (more details), 2.9 Å
SCOP Domain Sequences for d1fo1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo1b1 c.10.2.3 (B:) mRNA export factor tap {Human (Homo sapiens)}
elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
dgnslcdtfrdqstyisairerfpkllrldghelpppiafdve
Timeline for d1fo1b1: