SCOPe 2.07: Domain d4qw3b_: 4qw3 B:

Lineage for d4qw3b_ (4qw3 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qw3b_: 4qw3 B: [308666]
   Other proteins in same PDB: d4qw3a_, d4qw3c_, d4qw3d_, d4qw3e_, d4qw3g_, d4qw3i_, d4qw3j_, d4qw3k_, d4qw3l_, d4qw3n_, d4qw3o_, d4qw3q_, d4qw3r_, d4qw3s_, d4qw3u_, d4qw3w_, d4qw3x_, d4qw3y_, d4qw3z_
   automated match to d1rypc_
   complexed with bo2, cl, mg; mutant

Details for d4qw3b_

PDB Entry: 4qw3, 2.9 Å

PDB Description: yCP beta5-C63F mutant in complex with bortezomib

PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qw3b_:

Sequence; same for both SEQRES and ATOM records:

>d4qw3b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4qw3b_:

• d4qw3b_ first appeared in SCOPe 2.06
  
• d4qw3b_ appears in the current release, SCOPe 2.08