Lineage for d4qw1q_ (4qw1 Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602288Domain d4qw1q_: 4qw1 Q: [308656]
    Other proteins in same PDB: d4qw1a_, d4qw1b_, d4qw1d_, d4qw1e_, d4qw1f_, d4qw1g_, d4qw1h_, d4qw1i_, d4qw1j_, d4qw1k_, d4qw1l_, d4qw1m_, d4qw1n_, d4qw1o_, d4qw1p_, d4qw1r_, d4qw1s_, d4qw1t_, d4qw1u_, d4qw1v_, d4qw1w_, d4qw1x_, d4qw1y_, d4qw1z_
    automated match to d4eu2a_
    complexed with bo2, cl, mg; mutant

Details for d4qw1q_

PDB Entry: 4qw1 (more details), 2.9 Å

PDB Description: yCP beta5-A50V mutant in complex with bortezomib
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qw1q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qw1q_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qw1q_:

Click to download the PDB-style file with coordinates for d4qw1q_.
(The format of our PDB-style files is described here.)

Timeline for d4qw1q_: