Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qw1q_: 4qw1 Q: [308656] Other proteins in same PDB: d4qw1a_, d4qw1b_, d4qw1d_, d4qw1e_, d4qw1f_, d4qw1g_, d4qw1h_, d4qw1i_, d4qw1j_, d4qw1k_, d4qw1l_, d4qw1m_, d4qw1n_, d4qw1o_, d4qw1p_, d4qw1r_, d4qw1s_, d4qw1t_, d4qw1u_, d4qw1v_, d4qw1w_, d4qw1x_, d4qw1y_, d4qw1z_ automated match to d4eu2a_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qw1 (more details), 2.9 Å
SCOPe Domain Sequences for d4qw1q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qw1q_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qw1q_: