Lineage for d1fs2c2 (1fs2 C:146-401)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamiliesSuperfamily c.10.1: RNI-like [52047] (4 families) 
regular structure consisting of similar repeats
Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein)
this is a repeat family; one repeat unit is 1fqv C:251-227 found in domainProtein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52057] (4 PDB entries) 
Domain d1fs2c2: 1fs2 C:146-401 [30865]
Other proteins in same PDB: d1fs2a1, d1fs2b1, d1fs2b2, d1fs2c1, d1fs2d1, d1fs2d2
Details for d1fs2c2
PDB Entry: 1fs2 (more details), 2.9 Å
PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex
PDB Compounds: (C:) skp2SCOPe Domain Sequences for d1fs2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs2c2 c.10.1.3 (C:146-401) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}
eslwqtldefrvqhmdlsnsvievstlhgilsqcsklqnlsleglrlsdpivntlaknsn
lvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhvqvavahvsetitqlnls
gyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffqlnylqhlslsrcydiipe
tllelgeiptlktlqvfgivpdgtlqllkealphlqin
SCOPe Domain Coordinates for d1fs2c2:
Click to download the PDB-style file with coordinates for d1fs2c2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fs2c2:
View in 3D
