Lineage for d1fs2c2 (1fs2 C:146-401)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119773Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 119774Superfamily c.10.1: RNI-like [52047] (3 families) (S)
  5. 119796Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein)
    this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain
  6. 119797Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species)
  7. 119798Species Human (Homo sapiens) [TaxId:9606] [52057] (2 PDB entries)
  8. 119808Domain d1fs2c2: 1fs2 C:146-401 [30865]
    Other proteins in same PDB: d1fs2a1, d1fs2b1, d1fs2b2, d1fs2c1, d1fs2d1, d1fs2d2

Details for d1fs2c2

PDB Entry: 1fs2 (more details), 2.9 Å

PDB Description: insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fs2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs2c2 c.10.1.3 (C:146-401) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens)}
eslwqtldefrvqhmdlsnsvievstlhgilsqcsklqnlsleglrlsdpivntlaknsn
lvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhvqvavahvsetitqlnls
gyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffqlnylqhlslsrcydiipe
tllelgeiptlktlqvfgivpdgtlqllkealphlqin

SCOP Domain Coordinates for d1fs2c2:

Click to download the PDB-style file with coordinates for d1fs2c2.
(The format of our PDB-style files is described here.)

Timeline for d1fs2c2: