![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.1: RNI-like [52047] (3 families) ![]() regular structure consisting of similar repeats |
![]() | Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein) this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain |
![]() | Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52057] (2 PDB entries) |
![]() | Domain d1fs2a2: 1fs2 A:146-401 [30864] Other proteins in same PDB: d1fs2a1, d1fs2b1, d1fs2b2, d1fs2c1, d1fs2d1, d1fs2d2 |
PDB Entry: 1fs2 (more details), 2.9 Å
SCOP Domain Sequences for d1fs2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fs2a2 c.10.1.3 (A:146-401) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens)} eslwqtldefrvqhmdlsnsvievstlhgilsqcsklqnlsleglrlsdpivntlaknsn lvrlnlsgcsgfsefalqtllsscsrldelnlswcfdftekhvqvavahvsetitqlnls gyrknlqksdlstlvrrcpnlvhldlsdsvmlkndcfqeffqlnylqhlslsrcydiipe tllelgeiptlktlqvfgivpdgtlqllkealphlqin
Timeline for d1fs2a2: