Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d4qvyc_: 4qvy C: [308595] Other proteins in same PDB: d4qvya_, d4qvyb_, d4qvyd_, d4qvye_, d4qvyf_, d4qvyg_, d4qvyh_, d4qvyi_, d4qvyj_, d4qvyk_, d4qvyl_, d4qvym_, d4qvyn_, d4qvyo_, d4qvyp_, d4qvyr_, d4qvys_, d4qvyt_, d4qvyu_, d4qvyv_, d4qvyw_, d4qvyx_, d4qvyy_, d4qvyz_ automated match to d4eu2a_ complexed with bo2, cl, mg; mutant |
PDB Entry: 4qvy (more details), 2.51 Å
SCOPe Domain Sequences for d4qvyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qvyc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4qvyc_: