Lineage for d1fqve2 (1fqv E:146-431)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480149Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 480150Superfamily c.10.1: RNI-like [52047] (3 families) (S)
    regular structure consisting of similar repeats
  5. 480177Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein)
    this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain
  6. 480178Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species)
  7. 480179Species Human (Homo sapiens) [TaxId:9606] [52057] (2 PDB entries)
  8. 480184Domain d1fqve2: 1fqv E:146-431 [30858]
    Other proteins in same PDB: d1fqva1, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvd1, d1fqvd2, d1fqve1, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvp1, d1fqvp2

Details for d1fqve2

PDB Entry: 1fqv (more details), 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

SCOP Domain Sequences for d1fqve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqve2 c.10.1.3 (E:146-431) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens)}
eslwqtldltgknlhpdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvi
evstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtlls
scsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlv
hldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpd
gtlqllkealphlqincshfttiarptignkknqeiwgikcrltlq

SCOP Domain Coordinates for d1fqve2:

Click to download the PDB-style file with coordinates for d1fqve2.
(The format of our PDB-style files is described here.)

Timeline for d1fqve2: