SCOPe 2.07: Domain d4qvwj_: 4qvw J:

Lineage for d4qvwj_ (4qvw J:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qvwj_: 4qvw J: [308577]
   Other proteins in same PDB: d4qvwb_, d4qvwc_, d4qvwf_, d4qvwg_, d4qvwh_, d4qvwm_, d4qvwp_, d4qvwq_, d4qvwt_, d4qvwu_, d4qvwv_
   automated match to d4j70j_
   complexed with bo2, cl, mg; mutant

Details for d4qvwj_

PDB Entry: 4qvw, 3 Å

PDB Description: yCP beta5-A49S-mutant in complex with bortezomib

PDB Compounds: (J:) Proteasome subunit beta type-4

SCOPe Domain Sequences for d4qvwj_:

Sequence; same for both SEQRES and ATOM records:

>d4qvwj_ d.153.1.4 (J:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddf

Timeline for d4qvwj_:

• d4qvwj_ first appeared in SCOPe 2.06
  
• d4qvwj_ appears in the current release, SCOPe 2.08