SCOPe 2.05: Domain d1yrgb_: 1yrg B:

Lineage for d1yrgb_ (1yrg B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.1: RNI-like [52047] (4 families)
   regular structure consisting of similar repeats

5. Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein)
   this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain

6. Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species)
   GTPase-activating protein for SpI1, ortologue of Ran
   duplication: consists of 11 repeats

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (4 PDB entries)

8. Domain d1yrgb_: 1yrg B: [30855]

Details for d1yrgb_

PDB Entry: 1yrg, 2.66 Å

PDB Description: the crystal structure of rna1p: a new fold for a gtpase-activating protein

PDB Compounds: (B:) gtpase-activating protein rna1_schpo

SCOPe Domain Sequences for d1yrgb_:

Sequence; same for both SEQRES and ATOM records:

>d1yrgb_ c.10.1.2 (B:) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme

Timeline for d1yrgb_:

• d1yrgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1yrgb_ appears in SCOPe 2.04
  
• d1yrgb_ appears in SCOPe 2.06
  
• d1yrgb_ appears in the current release, SCOPe 2.08