Lineage for d1yrga_ (1yrg A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834684Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 1834714Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein)
    this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain
  6. 1834715Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species)
    GTPase-activating protein for SpI1, ortologue of Ran
    duplication: consists of 11 repeats
  7. 1834716Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (4 PDB entries)
  8. 1834719Domain d1yrga_: 1yrg A: [30854]

Details for d1yrga_

PDB Entry: 1yrg (more details), 2.66 Å

PDB Description: the crystal structure of rna1p: a new fold for a gtpase-activating protein
PDB Compounds: (A:) gtpase-activating protein rna1_schpo

SCOPe Domain Sequences for d1yrga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrga_ c.10.1.2 (A:) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme

SCOPe Domain Coordinates for d1yrga_:

Click to download the PDB-style file with coordinates for d1yrga_.
(The format of our PDB-style files is described here.)

Timeline for d1yrga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yrgb_