![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.1: RNI-like [52047] (4 families) ![]() regular structure consisting of similar repeats |
![]() | Family c.10.1.1: 28-residue LRR [52048] (3 proteins) this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain |
![]() | Protein Ribonuclease inhibitor [52049] (2 species) duplication: consists of 16 repeats |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52051] (1 PDB entry) |
![]() | Domain d1a4yd_: 1a4y D: [30853] Other proteins in same PDB: d1a4yb_, d1a4ye_ |
PDB Entry: 1a4y (more details), 2 Å
SCOPe Domain Sequences for d1a4yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4yd_ c.10.1.1 (D:) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} sldiqsldiqceelsdarwaellpllqqcqvvrlddcgltearckdissalrvnpalael nlrsnelgdvgvhcvlqglqtpsckiqklslqnccltgagcgvlsstlrtlptlqelhls dnllgdaglqllceglldpqcrleklqleycslsaasceplasvlrakpdfkeltvsnnd ineagvrvlcqglkdspcqlealklescgvtsdncrdlcgivaskaslrelalgsnklgd vgmaelcpgllhpssrlrtlwiwecgitakgcgdlcrvlrakeslkelslagnelgdega rllcetllepgcqleslwvkscsftaaccshfssvlaqnrfllelqisnnrledagvrel cqglgqpgsvlrvlwladcdvsdsscsslaatllanhslreldlsnnclgdagilqlves vrqpgclleqlvlydiywseemedrlqalekdkpslrvis
Timeline for d1a4yd_: