Lineage for d1dfji_ (1dfj I:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111497Superfamily c.10.1: RNI-like [52047] (4 families) (S)
    regular structure consisting of similar repeats
  5. 2111498Family c.10.1.1: 28-residue LRR [52048] (3 proteins)
    this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain
  6. 2111499Protein Ribonuclease inhibitor [52049] (2 species)
    duplication: consists of 16 repeats
  7. 2111503Species Pig (Sus scrofa) [TaxId:9823] [52050] (2 PDB entries)
  8. 2111505Domain d1dfji_: 1dfj I: [30851]
    Other proteins in same PDB: d1dfje_
    complexed with so4

Details for d1dfji_

PDB Entry: 1dfj (more details), 2.5 Å

PDB Description: ribonuclease inhibitor complexed with ribonuclease a
PDB Compounds: (I:) ribonuclease inhibitor

SCOPe Domain Sequences for d1dfji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfji_ c.10.1.1 (I:) Ribonuclease inhibitor {Pig (Sus scrofa) [TaxId: 9823]}
mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
gcaleqlvlydtywteevedrlqalegskpglrvis

SCOPe Domain Coordinates for d1dfji_:

Click to download the PDB-style file with coordinates for d1dfji_.
(The format of our PDB-style files is described here.)

Timeline for d1dfji_: