Lineage for d1dfji_ (1dfj I:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119773Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 119774Superfamily c.10.1: RNI-like [52047] (3 families) (S)
  5. 119775Family c.10.1.1: Ribonuclease inhibitor [52048] (1 protein)
    this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain
  6. 119776Protein Ribonuclease inhibitor [52049] (2 species)
  7. 119780Species Pig (Sus scrofa) [TaxId:9823] [52050] (2 PDB entries)
  8. 119782Domain d1dfji_: 1dfj I: [30851]
    Other proteins in same PDB: d1dfje_

Details for d1dfji_

PDB Entry: 1dfj (more details), 2.5 Å

PDB Description: ribonuclease inhibitor complexed with ribonuclease a

SCOP Domain Sequences for d1dfji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfji_ c.10.1.1 (I:) Ribonuclease inhibitor {Pig (Sus scrofa)}
mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
gcaleqlvlydtywteevedrlqalegskpglrvis

SCOP Domain Coordinates for d1dfji_:

Click to download the PDB-style file with coordinates for d1dfji_.
(The format of our PDB-style files is described here.)

Timeline for d1dfji_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dfje_