SCOP 1.63: Domain d2bnh__: 2bnh -

Lineage for d2bnh__ (2bnh -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N

4. Superfamily c.10.1: RNI-like [52047] (3 families)
   regular structure consisting of similar repeats

5. Family c.10.1.1: 28-residue LRR [52048] (2 proteins)
   this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain

6. Protein Ribonuclease inhibitor [52049] (2 species)
   duplication: consists of 16 repeats

7. Species Pig (Sus scrofa) [TaxId:9823] [52050] (2 PDB entries)

8. Domain d2bnh__: 2bnh - [30850]
   complexed with ace

Details for d2bnh__

PDB Entry: 2bnh, 2.3 Å

PDB Description: porcine ribonuclease inhibitor

SCOP Domain Sequences for d2bnh__:

Sequence; same for both SEQRES and ATOM records:

>d2bnh__ c.10.1.1 (-) Ribonuclease inhibitor {Pig (Sus scrofa)}
mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
gcaleqlvlydtywteevedrlqalegskpglrvis

Timeline for d2bnh__:

• d2bnh__ first appeared (with stable ids) in SCOP 1.55
  
• d2bnh__ appears in SCOP 1.61
  
• d2bnh__ appears in SCOP 1.65
  
• d2bnh__ appears in the current release, SCOPe 2.08, called d2bnha_