Lineage for d2bnh__ (2bnh -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119773Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 119774Superfamily c.10.1: RNI-like [52047] (3 families) (S)
  5. 119775Family c.10.1.1: Ribonuclease inhibitor [52048] (1 protein)
    this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain
  6. 119776Protein Ribonuclease inhibitor [52049] (2 species)
  7. 119780Species Pig (Sus scrofa) [TaxId:9823] [52050] (2 PDB entries)
  8. 119781Domain d2bnh__: 2bnh - [30850]

Details for d2bnh__

PDB Entry: 2bnh (more details), 2.3 Å

PDB Description: porcine ribonuclease inhibitor

SCOP Domain Sequences for d2bnh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnh__ c.10.1.1 (-) Ribonuclease inhibitor {Pig (Sus scrofa)}
mnldihceqlsdarwtellpllqqyevvrlddcglteehckdigsalranpsltelclrt
nelgdagvhlvlqglqsptckiqklslqncslteagcgvlpstlrslptlrelhlsdnpl
gdaglrllceglldpqchleklqleycrltaasceplasvlratralkeltvsnndigea
garvlgqgladsacqletlrlencgltpanckdlcgivasqaslreldlgsnglgdagia
elcpgllspasrlktlwlwecditasgcrdlcrvlqaketlkelslagnklgdegarllc
esllqpgcqleslwvkscsltaaccqhvslmltqnkhllelqlssnklgdsgiqelcqal
sqpgttlrvlclgdcevtnsgcsslaslllanrslreldlsnncvgdpgvlqllgsleqp
gcaleqlvlydtywteevedrlqalegskpglrvis

SCOP Domain Coordinates for d2bnh__:

Click to download the PDB-style file with coordinates for d2bnh__.
(The format of our PDB-style files is described here.)

Timeline for d2bnh__: