SCOPe 2.07: Domain d4qvnv_: 4qvn V:

Lineage for d4qvnv_ (4qvn V:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qvnv_: 4qvn V: [308492]
   Other proteins in same PDB: d4qvna_, d4qvnc_, d4qvnd_, d4qvne_, d4qvng_, d4qvni_, d4qvnj_, d4qvnk_, d4qvnl_, d4qvnn_, d4qvno_, d4qvnq_, d4qvnr_, d4qvns_, d4qvnu_, d4qvnw_, d4qvnx_, d4qvny_, d4qvnz_
   automated match to d4r17h_
   complexed with bo2, cl, mg; mutant

Details for d4qvnv_

PDB Entry: 4qvn, 2.9 Å

PDB Description: yCP beta5-M45V mutant in complex with bortezomib

PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4qvnv_:

Sequence; same for both SEQRES and ATOM records:

>d4qvnv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

Timeline for d4qvnv_:

• d4qvnv_ first appeared in SCOPe 2.06
  
• d4qvnv_ appears in the current release, SCOPe 2.08