Lineage for d1ffkv_ (1ffk V:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834563Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 1834621Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 1834622Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 1834623Protein Ribosomal protein L32e [52044] (1 species)
  7. 1834624Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 1834682Domain d1ffkv_: 1ffk V: [30849]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    complexed with cd, k, mg

Details for d1ffkv_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (V:) ribosomal protein l32e

SCOPe Domain Sequences for d1ffkv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkv_ c.9.2.1 (V:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
qargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgi
kgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavrinskvgarkreri
eeeaedagirvlnptyvevevse

SCOPe Domain Coordinates for d1ffkv_:

Click to download the PDB-style file with coordinates for d1ffkv_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkv_: