![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) |
![]() | Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) ![]() |
![]() | Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein) |
![]() | Protein Barstar (barnase inhibitor) [52040] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries) |
![]() | Domain d1b3sf_: 1b3s F: [30848] Other proteins in same PDB: d1b3sa_, d1b3sb_, d1b3sc_ |
PDB Entry: 1b3s (more details), 2.39 Å
SCOP Domain Sequences for d1b3sf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3sf_ c.9.1.1 (F:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens} kkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfeqsk qltengaesvlqvfreakaegcditiils
Timeline for d1b3sf_: