Lineage for d1b3se_ (1b3s E:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823885Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 823886Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
  5. 823887Family c.9.1.1: Barstar-related [52039] (2 proteins)
  6. 823888Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 823889Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries)
  8. 823916Domain d1b3se_: 1b3s E: [30847]
    Other proteins in same PDB: d1b3sa_, d1b3sb_, d1b3sc_

Details for d1b3se_

PDB Entry: 1b3s (more details), 2.39 Å

PDB Description: structural response to mutation at a protein-protein interface
PDB Compounds: (E:) protein (barstar)

SCOP Domain Sequences for d1b3se_:

Sequence, based on SEQRES records: (download)

>d1b3se_ c.9.1.1 (E:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils

Sequence, based on observed residues (ATOM records): (download)

>d1b3se_ c.9.1.1 (E:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfgaes
vlqvfreakaegcditiils

SCOP Domain Coordinates for d1b3se_:

Click to download the PDB-style file with coordinates for d1b3se_.
(The format of our PDB-style files is described here.)

Timeline for d1b3se_: