Lineage for d1b3sd_ (1b3s D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21426Fold c.9: Barstar-like [52037] (2 superfamilies)
  4. 21427Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) (S)
  5. 21428Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein)
  6. 21429Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 21430Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries)
  8. 21447Domain d1b3sd_: 1b3s D: [30846]
    Other proteins in same PDB: d1b3sa_, d1b3sb_, d1b3sc_

Details for d1b3sd_

PDB Entry: 1b3s (more details), 2.39 Å

PDB Description: structural response to mutation at a protein-protein interface

SCOP Domain Sequences for d1b3sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3sd_ c.9.1.1 (D:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
mkkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfeqs
kqltengaesvlqvfreakaegcditiils

SCOP Domain Coordinates for d1b3sd_:

Click to download the PDB-style file with coordinates for d1b3sd_.
(The format of our PDB-style files is described here.)

Timeline for d1b3sd_: