SCOPe 2.07: Domain d4qvlb_: 4qvl B:

Lineage for d4qvlb_ (4qvl B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qvlb_: 4qvl B: [308426]
   Other proteins in same PDB: d4qvla_, d4qvlc_, d4qvld_, d4qvle_, d4qvlg_, d4qvli_, d4qvlj_, d4qvlk_, d4qvll_, d4qvln_, d4qvlo_, d4qvlq_, d4qvlr_, d4qvls_, d4qvlu_, d4qvlw_, d4qvlx_, d4qvly_, d4qvlz_
   automated match to d1rypc_
   complexed with bo2, cl, mg

Details for d4qvlb_

PDB Entry: 4qvl, 2.8 Å

PDB Description: yCP in complex with bortezomib

PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qvlb_:

Sequence; same for both SEQRES and ATOM records:

>d4qvlb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4qvlb_:

• d4qvlb_ first appeared in SCOPe 2.06
  
• d4qvlb_ appears in the current release, SCOPe 2.08