Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qvlb_: 4qvl B: [308426] Other proteins in same PDB: d4qvla_, d4qvlc_, d4qvld_, d4qvle_, d4qvlg_, d4qvli_, d4qvlj_, d4qvlk_, d4qvll_, d4qvln_, d4qvlo_, d4qvlq_, d4qvlr_, d4qvls_, d4qvlu_, d4qvlw_, d4qvlx_, d4qvly_, d4qvlz_ automated match to d1rypc_ complexed with bo2, cl, mg |
PDB Entry: 4qvl (more details), 2.8 Å
SCOPe Domain Sequences for d4qvlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qvlb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qvlb_: