![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) |
![]() | Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) ![]() |
![]() | Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein) |
![]() | Protein Barstar (barnase inhibitor) [52040] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries) |
![]() | Domain d1b27f_: 1b27 F: [30842] Other proteins in same PDB: d1b27a_, d1b27b_, d1b27c_ |
PDB Entry: 1b27 (more details), 2.1 Å
SCOP Domain Sequences for d1b27f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b27f_ c.9.1.1 (F:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens} kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk qltengaesvlqvfreakaegaditiils
Timeline for d1b27f_: