Lineage for d1b27d_ (1b27 D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67742Fold c.9: Barstar-like [52037] (2 superfamilies)
  4. 67743Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) (S)
  5. 67744Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein)
  6. 67745Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 67746Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries)
  8. 67754Domain d1b27d_: 1b27 D: [30840]
    Other proteins in same PDB: d1b27a_, d1b27b_, d1b27c_

Details for d1b27d_

PDB Entry: 1b27 (more details), 2.1 Å

PDB Description: structural response to mutation at a protein-protein interface

SCOP Domain Sequences for d1b27d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b27d_ c.9.1.1 (D:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
mkkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqs
kqltengaesvlqvfreakaegaditiils

SCOP Domain Coordinates for d1b27d_:

Click to download the PDB-style file with coordinates for d1b27d_.
(The format of our PDB-style files is described here.)

Timeline for d1b27d_: