Lineage for d4qv8q_ (4qv8 Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602302Domain d4qv8q_: 4qv8 Q: [308392]
    Other proteins in same PDB: d4qv8a_, d4qv8b_, d4qv8d_, d4qv8e_, d4qv8f_, d4qv8g_, d4qv8h_, d4qv8i_, d4qv8j_, d4qv8k_, d4qv8l_, d4qv8m_, d4qv8n_, d4qv8o_, d4qv8p_, d4qv8r_, d4qv8s_, d4qv8t_, d4qv8u_, d4qv8v_, d4qv8w_, d4qv8x_, d4qv8y_, d4qv8z_
    automated match to d4eu2a_
    complexed with cl, mg; mutant

Details for d4qv8q_

PDB Entry: 4qv8 (more details), 2.9 Å

PDB Description: yCP beta5-C52F mutant
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qv8q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv8q_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qv8q_:

Click to download the PDB-style file with coordinates for d4qv8q_.
(The format of our PDB-style files is described here.)

Timeline for d4qv8q_: