SCOPe 2.07: Domain d4qv8p_: 4qv8 P:

Lineage for d4qv8p_ (4qv8 P:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qv8p_: 4qv8 P: [308391]
   Other proteins in same PDB: d4qv8a_, d4qv8c_, d4qv8d_, d4qv8e_, d4qv8g_, d4qv8i_, d4qv8j_, d4qv8k_, d4qv8l_, d4qv8n_, d4qv8o_, d4qv8q_, d4qv8r_, d4qv8s_, d4qv8u_, d4qv8w_, d4qv8x_, d4qv8y_, d4qv8z_
   automated match to d1rypc_
   complexed with cl, mg; mutant

Details for d4qv8p_

PDB Entry: 4qv8, 2.9 Å

PDB Description: yCP beta5-C52F mutant

PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qv8p_:

Sequence; same for both SEQRES and ATOM records:

>d4qv8p_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4qv8p_:

• d4qv8p_ first appeared in SCOPe 2.06
  
• d4qv8p_ appears in the current release, SCOPe 2.08