Lineage for d1b2sf_ (1b2s F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851515Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
    automatically mapped to Pfam PF01337
  5. 2851516Family c.9.1.1: Barstar-related [52039] (3 proteins)
  6. 2851517Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 2851518Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries)
  8. 2851522Domain d1b2sf_: 1b2s F: [30839]
    Other proteins in same PDB: d1b2sa_, d1b2sb_, d1b2sc_
    protein/RNA complex; complexed with so4; mutant

Details for d1b2sf_

PDB Entry: 1b2s (more details), 1.82 Å

PDB Description: structural response to mutation at a protein-protein interface
PDB Compounds: (F:) protein (barstar)

SCOPe Domain Sequences for d1b2sf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2sf_ c.9.1.1 (F:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdclagwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils

SCOPe Domain Coordinates for d1b2sf_:

Click to download the PDB-style file with coordinates for d1b2sf_.
(The format of our PDB-style files is described here.)

Timeline for d1b2sf_: