Lineage for d1b2sd_ (1b2s D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67742Fold c.9: Barstar-like [52037] (2 superfamilies)
  4. 67743Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) (S)
  5. 67744Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein)
  6. 67745Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 67746Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries)
  8. 67748Domain d1b2sd_: 1b2s D: [30837]
    Other proteins in same PDB: d1b2sa_, d1b2sb_, d1b2sc_

Details for d1b2sd_

PDB Entry: 1b2s (more details), 1.82 Å

PDB Description: structural response to mutation at a protein-protein interface

SCOP Domain Sequences for d1b2sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2sd_ c.9.1.1 (D:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
mkkavingeqirsisdlhqtlkkelalpeyygenldalwdclagwveyplvlewrqfeqs
kqltengaesvlqvfreakaegcditiils

SCOP Domain Coordinates for d1b2sd_:

Click to download the PDB-style file with coordinates for d1b2sd_.
(The format of our PDB-style files is described here.)

Timeline for d1b2sd_: