Lineage for d1b2sd_ (1b2s D:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.9: Barstar-like [52037] (2 superfamilies) Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) 
Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein) Protein Barstar (barnase inhibitor) [52040] (1 species) Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries) 
Domain d1b2sd_: 1b2s D: [30837]
Other proteins in same PDB: d1b2sa_, d1b2sb_, d1b2sc_
Details for d1b2sd_
PDB Entry: 1b2s (more details), 1.82 Å
PDB Description: structural response to mutation at a protein-protein interface
SCOP Domain Sequences for d1b2sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b2sd_ c.9.1.1 (D:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
mkkavingeqirsisdlhqtlkkelalpeyygenldalwdclagwveyplvlewrqfeqs
kqltengaesvlqvfreakaegcditiils
SCOP Domain Coordinates for d1b2sd_:
Click to download the PDB-style file with coordinates for d1b2sd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b2sd_:
- d1b2sd_ appears in SCOP 1.57
- d1b2sd_ appears in the current release, SCOPe 2.08
View in 3D
