SCOPe 2.07: Domain d1ay7b_: 1ay7 B:

Lineage for d1ay7b_ (1ay7 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.1: Barstar-related [52038] (1 family)
   automatically mapped to Pfam PF01337

5. Family c.9.1.1: Barstar-related [52039] (3 proteins)

6. Protein Barstar (barnase inhibitor) [52040] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries)

8. Domain d1ay7b_: 1ay7 B: [30836]
   Other proteins in same PDB: d1ay7a_

Details for d1ay7b_

PDB Entry: 1ay7, 1.7 Å

PDB Description: ribonuclease sa complex with barstar

PDB Compounds: (B:) barstar

SCOPe Domain Sequences for d1ay7b_:

Sequence; same for both SEQRES and ATOM records:

>d1ay7b_ c.9.1.1 (B:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils

Timeline for d1ay7b_:

• d1ay7b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ay7b_ appears in SCOPe 2.06
  
• d1ay7b_ appears in the current release, SCOPe 2.08