Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) |
Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) |
Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein) |
Protein Barstar (barnase inhibitor) [52040] (1 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries) |
Domain d1ab7__: 1ab7 - [30835] |
PDB Entry: 1ab7 (more details)
SCOP Domain Sequences for d1ab7__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ab7__ c.9.1.1 (-) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens} kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk qltengaesvlqvfreakaegaditiils
Timeline for d1ab7__: