Lineage for d1btb__ (1btb -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67742Fold c.9: Barstar-like [52037] (2 superfamilies)
  4. 67743Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) (S)
  5. 67744Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein)
  6. 67745Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 67746Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries)
  8. 67770Domain d1btb__: 1btb - [30834]

Details for d1btb__

PDB Entry: 1btb (more details)

PDB Description: three-dimensional solution structure and 13c assignments of barstar using nuclear magnetic resonance spectroscopy

SCOP Domain Sequences for d1btb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btb__ c.9.1.1 (-) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils

SCOP Domain Coordinates for d1btb__:

Click to download the PDB-style file with coordinates for d1btb__.
(The format of our PDB-style files is described here.)

Timeline for d1btb__: