SCOP 1.55: Domain d1btb__: 1btb -

Lineage for d1btb__ (1btb -)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)

4. Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family)

5. Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein)

6. Protein Barstar (barnase inhibitor) [52040] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries)

8. Domain d1btb__: 1btb - [30834]

Details for d1btb__

PDB Entry: 1btb

PDB Description: three-dimensional solution structure and 13c assignments of barstar using nuclear magnetic resonance spectroscopy

SCOP Domain Sequences for d1btb__:

Sequence; same for both SEQRES and ATOM records:

>d1btb__ c.9.1.1 (-) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils

Timeline for d1btb__:

• d1btb__ appears in SCOP 1.57
  
• d1btb__ appears in the current release, SCOPe 2.08, called d1btba_