![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) |
![]() | Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) ![]() |
![]() | Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein) |
![]() | Protein Barstar (barnase inhibitor) [52040] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries) |
![]() | Domain d1a19b_: 1a19 B: [30832] |
PDB Entry: 1a19 (more details), 2.76 Å
SCOP Domain Sequences for d1a19b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a19b_ c.9.1.1 (B:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens} kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk qltengaesvlqvfreakaegaditiils
Timeline for d1a19b_: