Lineage for d1a19a_ (1a19 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67742Fold c.9: Barstar-like [52037] (2 superfamilies)
  4. 67743Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) (S)
  5. 67744Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein)
  6. 67745Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 67746Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries)
  8. 67766Domain d1a19a_: 1a19 A: [30831]

Details for d1a19a_

PDB Entry: 1a19 (more details), 2.76 Å

PDB Description: barstar (free), c82a mutant

SCOP Domain Sequences for d1a19a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a19a_ c.9.1.1 (A:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegaditiils

SCOP Domain Coordinates for d1a19a_:

Click to download the PDB-style file with coordinates for d1a19a_.
(The format of our PDB-style files is described here.)

Timeline for d1a19a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a19b_