Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.1: Barstar-related [52038] (1 family) |
Family c.9.1.1: Barstar-related [52039] (2 proteins) |
Protein Barstar (barnase inhibitor) [52040] (1 species) |
Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (12 PDB entries) |
Domain d1brsf_: 1brs F: [30827] Other proteins in same PDB: d1brsa_, d1brsb_, d1brsc_ mutant |
PDB Entry: 1brs (more details), 2 Å
SCOP Domain Sequences for d1brsf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brsf_ c.9.1.1 (F:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]} kkavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqsk qltengaesvlqvfreakaegaditiils
Timeline for d1brsf_: