Lineage for d1brse_ (1brs E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851515Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
    automatically mapped to Pfam PF01337
  5. 2851516Family c.9.1.1: Barstar-related [52039] (3 proteins)
  6. 2851517Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 2851518Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (15 PDB entries)
  8. 2851541Domain d1brse_: 1brs E: [30826]
    Other proteins in same PDB: d1brsa_, d1brsb_, d1brsc_

Details for d1brse_

PDB Entry: 1brs (more details), 2 Å

PDB Description: protein-protein recognition: crystal structural analysis of a barnase- barstar complex at 2.0-a resolution
PDB Compounds: (E:) barstar

SCOPe Domain Sequences for d1brse_:

Sequence, based on SEQRES records: (download)

>d1brse_ c.9.1.1 (E:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqskq
ltengaesvlqvfreakaegaditiils

Sequence, based on observed residues (ATOM records): (download)

>d1brse_ c.9.1.1 (E:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens [TaxId: 1390]}
kavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqskq
ltgaesvlqvfreakaegaditiils

SCOPe Domain Coordinates for d1brse_:

Click to download the PDB-style file with coordinates for d1brse_.
(The format of our PDB-style files is described here.)

Timeline for d1brse_: