Lineage for d1a6eb2 (1a6e B:216-367)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 389637Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 389744Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 389875Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)
  6. 389876Protein Thermosome, A-domain [52035] (4 species)
  7. 389903Species Archaeon Thermoplasma acidophilum, beta chain [TaxId:2303] [100947] (3 PDB entries)
  8. 389904Domain d1a6eb2: 1a6e B:216-367 [30823]
    Other proteins in same PDB: d1a6ea1, d1a6ea3, d1a6eb1, d1a6eb3
    complexed with adp, af3, mg

Details for d1a6eb2

PDB Entry: 1a6e (more details), 3.2 Å

PDB Description: thermosome-mg-adp-alf3 complex

SCOP Domain Sequences for d1a6eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6eb2 c.8.5.2 (B:216-367) Thermosome, A-domain {Archaeon Thermoplasma acidophilum, beta chain}
giivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenmlr
emvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivstid
eisssdlgtaerveqvkvgedymtfvtgcknp

SCOP Domain Coordinates for d1a6eb2:

Click to download the PDB-style file with coordinates for d1a6eb2.
(The format of our PDB-style files is described here.)

Timeline for d1a6eb2: