| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in all proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) ![]() |
| Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein) |
| Protein Thermosome, A-domain [52035] (2 species) |
| Species Archaeon Thermoplasma acidophilum [TaxId:2303] [52036] (5 PDB entries) |
| Domain d1a6eb2: 1a6e B:216-367 [30823] Other proteins in same PDB: d1a6ea1, d1a6ea3, d1a6eb1, d1a6eb3 complexed with adp, af3, mg |
PDB Entry: 1a6e (more details), 3.2 Å
SCOP Domain Sequences for d1a6eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6eb2 c.8.5.2 (B:216-367) Thermosome, A-domain {Archaeon Thermoplasma acidophilum}
giivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenmlr
emvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivstid
eisssdlgtaerveqvkvgedymtfvtgcknp
Timeline for d1a6eb2: